نتایج جستجو برای: histone like protein

تعداد نتایج: 1804323  

Journal: :Human molecular genetics 2001
B P Chadwick H F Willard

MacroH2A1 is an unusual variant of the core histone H2A which is enriched in chromatin on the inactive X chromosome of female mammals. The N-terminal third of the protein shares 65% amino acid identity with core histone H2A, while the remaining two-thirds of the protein are novel, with a small stretch of basic amino acids and a putative leucine zipper motif. We have now cloned a second macroH2A...

Journal: :Biochimica et biophysica acta. Molecular cell research 2021

Coenzyme A (CoA) is a key molecule in cellular metabolism including the tricarboxylic acid cycle, fatty synthesis, amino synthesis and lipid metabolism. Moreover, CoA required for biological processes like protein post-translational modifications (PTMs) acylation. levels affect amount of histone acetylation thereby modulate gene expression. direct influence on other PTMs, CoAlation 4?-phosphopa...

2015
Christian Edlich-Muth Jean-Baptiste Artero Phil Callow Marcin R. Przewloka Aleksandra A. Watson Wei Zhang David M. Glover Janusz Debski Michal Dadlez Adam R. Round V. Trevor Forsyth Ernest D. Laue

Nucleoplasmin is a histone chaperone that consists of a pentameric N-terminal domain and an unstructured C-terminal tail. The pentameric core domain, a doughnut-like structure with a central pore, is only found in the nucleoplasmin family. Here, we report the first structure of a nucleoplasmin-like domain (NPL) from the unrelated Drosophila protein, FKBP39, and we present evidence that this pro...

2012
Chibawanye I. Ene Lincoln Edwards Gregory Riddick Mehmet Baysan Kevin Woolard Svetlana Kotliarova Chen Lai Galina Belova Maggie Cam Jennifer Walling Ming Zhou Holly Stevenson Hong Sug Kim Keith Killian Timothy Veenstra Rolanda Bailey Hua Song Wei Zhang Howard A. Fine

Histone methylation regulates normal stem cell fate decisions through a coordinated interplay between histone methyltransferases and demethylases at lineage specific genes. Malignant transformation is associated with aberrant accumulation of repressive histone modifications, such as polycomb mediated histone 3 lysine 27 (H3K27me3) resulting in a histone methylation mediated block to differentia...

Journal: :The Journal of biological chemistry 1991
L Jutglar J I Borrell J Ausió

We have analyzed the structure of the trypsin-resistant core of the protein PL-II* of the sperm from Mytilus californianus. The peptide has a molecular mass of 8436 Da and its primary sequence is ATGGAKKP STLSMIVAAIQAMKNRKGSSVQAIRKYILANNKG INTSRLGSAMKLAFAKGLKSGVLVRPKTSAGA SGATGSFRVG. This sequence bears an enormous homology and fulfills the constraints of the consensus sequence of the trypsin-r...

انصاری نژاد, نفیسه, رمیم, طیب, عباسی, بهاره, فرداد, فرشید, نصیری‌پور, سمیه,

Stable molecular changes during cell division without any change in the sequence of DNA molecules is known as epigenetic. Molecular mechanisms involved in this process, including histone modifications, methylation of DNA, protein complex and RNA antisense. Cancer genome changes happen through a combination of DNA hypermethylation, long-term epigenetic silencing with heterozygosis loss and genom...

2015
Keely A. Dulmage Horia Todor Amy K. Schmid

UNLABELLED In all three domains of life, organisms use nonspecific DNA-binding proteins to compact and organize the genome as well as to regulate transcription on a global scale. Histone is the primary eukaryotic nucleoprotein, and its evolutionary roots can be traced to the archaea. However, not all archaea use this protein as the primary DNA-packaging component, raising questions regarding th...

Journal: :medical journal of islamic republic of iran 0
azra rabbani from the institute of biochemistry and biophysics, university of tehran, islamic republic of iran. roya navab bahram goliaei

in this study the nature of chromosomal proteins, his tones and nonhistone in resident alveolar macrophages was investigated in comparison to peritoneal neutrophils and calf thymus proteins. cells were obtained by lavaging the lung and after purity determination they were subjected to fractional extraction procedures. proteins were then analysed on sds polyacrylamide gels and densitometric scan...

Journal: :The Journal of neuroscience : the official journal of the Society for Neuroscience 2009
Kyoko Koshibu Johannes Gräff Monique Beullens Fabrice D Heitz Dominik Berchtold Holger Russig Mélissa Farinelli Mathieu Bollen Isabelle M Mansuy

Chromatin remodeling through histone posttranslational modifications (PTMs) and DNA methylation has recently been implicated in cognitive functions, but the mechanisms involved in such epigenetic regulation remain poorly understood. Here, we show that protein phosphatase 1 (PP1) is a critical regulator of chromatin remodeling in the mammalian brain that controls histone PTMs and gene transcript...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید