نتایج جستجو برای: whole cell patch clamp

تعداد نتایج: 1950824  

Journal: :Seibutsu Butsuri 1985

Journal: :Biotechnology and bioengineering 2010
Christophe Py Mike W Denhoff Marzia Martina Robert Monette Tanya Comas Tarun Ahuja Dolores Martinez Simon Wingar Juan Caballero Sylvain Laframboise John Mielke Alexei Bogdanov Collin Luk Naweed Syed Geoff Mealing

We report on a simple and high-yield manufacturing process for silicon planar patch-clamp chips, which allow low capacitance and series resistance from individually identified cultured neurons. Apertures are etched in a high-quality silicon nitride film on a silicon wafer; wells are opened on the backside of the wafer by wet etching and passivated by a thick deposited silicon dioxide film to re...

2011
Yuriy Kirichok Polina V. Lishko

Upon ejaculation, mammalian spermatozoa have to undergo a sequence of physiological transformations within the female reproductive tract that will allow them to reach and fertilize the egg. These include initiation of motility, hyperactivation of motility and perhaps chemotaxis toward the egg, and culminate in the acrosome reaction that permits sperm to penetrate the protective vestments of the...

Journal: :Molecules 2014
Anna Fasoli Fabrizio Salomone Mascia Benedusi Claudia Boccardi Giorgio Rispoli Fabio Beltram Francesco Cardarelli

The membrane-destabilization properties of the recently-introduced endosomolytic CM18-Tat11 hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1-7 of cecropin-A, 2-12 of melittin, and 47-57 of HIV-1 Tat protein) are investigated in CHO-K1 cells by using the whole-cell configuration of the patch-clamp technique. CM18-Tat11, CM18, and Tat11 peptides are administered to the cell membrane wit...

Journal: :General physiology and biophysics 2005
P Novák I Zahradník

The conventional patch-clamp technique requires well-trained experimenter. Few commercial automated patch-clamp systems, designed for drug development, are better suited for large-scale research then for standard electrophysiological experiments. Here we describe a state machine for automated recognition of recording states of the patch-clamp experiment. The principle of the state machine is ba...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید