Objective(s) In this study, effects of chronic administration of oral natural honey against ischemia/reperfusion (I/R)-  induced cardiac arrhythmias were investigated in isolated rat heart. Materials and Methods Male Wistar rats were divided into four groups (n= 10-14 rats in each group) and fed with natural honey (1%, 2% and 4% dissolved in the drinking water) for 45 days except for the con...

We assume that phenylephrine produces late pharmacological preconditioning through the opening of the mitochondrial KATP channels. To test this hypothesis, rat hearts were isolated and perfused with Krebs buffer solution by Langendorff method and subjected to 30 min regional ischemia followed by 60 min of reperfusion. In this study, phenylephrine as a selective alpha1-adrenoceptor agonist and 5...

Background: The role of nitric oxide (NO) of endothelial or neuronal origins in cerebral ischemia and reperfusion injuries are far from being settled, extending from being important to not having any role at all.  Objective: To investigate the role of NO of endothelial and neuronal origins in ischemia/reperfusion injuries in focal cerebral ischemia, L-NAME, a non selective NO synthase inhibitor...

We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is per...

To the Editor: In a recent article, Cai and Semenza1 claim to have demonstrated a role for modulation of PTEN activity in the setting of ischemic preconditioning (IPC), using an isolated perfused rat heart. We believe the findings of this study are potentially of great significance as this study is the first to implicate PTEN in myocardial ischemia– reperfusion injury. However, we question the ...

Objective-The aim of the present study was to investigate the effects of curcumin nanoparticles (CNP) on stress oxidative following experimental ischemia-reperfusion injury in the rat testes. Design-Experimental Study Animals- Seventy-seven healthy male Wistar rats Procedures-The animals weighing approximately...

Bone marrow-derived mesenchymal stem cells (BM-MSCs) have been shown to attenuate ischemia reperfusion (IR) injury in the heart, brain and kidney. However, their exact roles in the liver remain to be defined. Our objective was to investigate the potential effects of BM-MSCs on a hepatic IR rat model during the first 24 h after reperfusion, a crucial period for hepatic IR damage formation. A rat...

Signal transducer and activator of transcription (STAT) is a unique protein family that binds to DNA, coupled with tyrosine phosphorylation signaling pathways, acting as a transcriptional regulator to mediate a variety of biological effects. Cerebral ischemia and reperfusion can activate STATs signaling pathway, but no studies have confirmed whether STAT activation can be verified by diffusion-...

The role of fatty acyl CoA synthetase (FACS) in ischemia/reperfusion (I/R) injury has not been well established. Our earlier studies showed that triacsin C, a selective FACS inhibitor, decreases endothelial nitric oxide synthase (eNOS) palmitoylation and increases nitric oxide (NO) in cultured human coronary endothelial cells. In the present study, we tested the hypothesis that triacsin C would...