نتایج جستجو برای: lf antennas

تعداد نتایج: 21237  

2009
Karl Crary

The standard methodology for representing deductive systems in LF identifies the object’s language’s context with the LF context. Consequently, any variable dealt with explicitly by any judgement or metatheorem must be last in the context. When the object language is dependently typed, this can pose a problem for establishing some metatheoretic results, since dependent hypotheses cannot be re-o...

Journal: :The American journal of physiology 1999
Terry B J Kuo Tsann Lin Cheryl C H Yang Chia-Lin Li Chieh-Fu Chen Pesus Chou

To clarify the influence of gender on sympathetic and parasympathetic control of heart rate in middle-aged subjects and on the subsequent aging process, heart rate variability (HRV) was studied in normal populations of women ( n = 598) and men ( n = 472) ranging in age from 40 to 79 yr. These groups were divided into eight age strata at 5-yr intervals and were clinically diagnosed as having no ...

Journal: :Spine 2016
Sang-Hun Lee Kyung-Soo Suk Kyung-Chung Kang Sung-Woo Cho Hyung-Suk Juh Jung-Hee Lee Ki-Tack Kim

STUDY DESIGN A retrospective study. OBJECTIVE The aim of this study was to analyze the clinical outcomes and related factors of C5 palsy (C5P) following posterior cervical laminectomy with fusion (LF) compared with laminoplasty (LP). SUMMARY OF BACKGROUND DATA C5P is more common after LF than after LP. There have not been any studies on C5P-LF compared with C5P-LP. METHODS We retrospectiv...

Journal: :The European respiratory journal 2003
K Dingli T Assimakopoulos P K Wraith I Fietze C Witt N J Douglas

A recent study has shown that daytime heart rate variability is reduced in obstructive sleep apnoea/hypopnoea syndrome (OSAHS) patients. In the present study, the hypothesis was that sympathovagal balance around apnoeas/hypopnoeas and nocturnal autonomic activity are altered in OSAHS patients. Frequency- and time-domain analyses of RR intervals were performed to monitor sympathovagal activity n...

2013
Patricia N. Okorie George O. Ademowo Yisa Saka Emmanuel Davies Chukwu Okoronkwo Moses J. Bockarie David H. Molyneux Louise A. Kelly-Hope

BACKGROUND Nigeria has a significant burden of lymphatic filariasis (LF) caused by the parasite Wuchereria bancrofti. A major concern to the expansion of the LF elimination programme is the risk of serious adverse events (SAEs) associated with the use of ivermectin in areas co-endemic with Loa filariasis. To better understand this, as well as other factors that may impact on LF elimination, we ...

Journal: :Spine 2016
Yun-qiang Xu Zhen-hui Zhang Yong-fa Zheng Shi-qing Feng

STUDY DESIGN A study of lumbar ligamentum flavum (LF). OBJECTIVE The aim of this study was to identify LF hypertrophy related microRNAs (miRNAs) expression profile and to investigate the role of miRNAs in the development of LF hypertrophy in lumbar spinal stenosis (LSS). SUMMARY OF BACKGROUND DATA Although histologic and biologic literature on LF hypertrophy is available, the pathomechanism...

Journal: :JPhys photonics 2021

Abstract We revisit low frequency coherent Raman spectroscopy (LF-CRS) and present a unified theoretical background that provides consistent physical pictures of LF-CRS signal generation. Our general framework allows to compute the noise ratio in multitude possible LF-CRS, more generally CRS, experimental implementations both spectral time domain.

Journal: :Oncology reports 2015
Jieyu Zhou Yongmei Li Dongmin Wei Ye Qian Wenming Li Dayu Liu Guojun Li Xinliang Pan Dapeng Lei

The aims of the present study were to review the experience of different surgical reconstruction methods for hypopharyngeal squamous cell carcinoma (HSCC) and compared the survival of patients with and without laryngeal function (LF) preservation. The clinical characteristics of 580 patients were retrospectively obtained and analyzed. Survival curves were analyzed using the Kaplan‑Meier method ...

Journal: :Turkish neurosurgery 2017
Baoshan Hu Gang Rui Naikun Sun Jinyi Feng Shengrong Lin

AIM To determine the efficacy, safety, and clinical value of a novel surgical procedure involving the blunt perforation of the ligamentum flavum (LF) during endoscopic interlaminar lumbar discectomy. MATERIAL AND METHODS This was a prospective study of 50 patients (27 males, 17-51 years of age) undergoing lumbar discectomy for single segment L4/L5 or L5/S1 disk herniation were grouped into th...

2011
Laetitia Carthagena Pierre Becquart Hakim Hocini Michel D Kazatchkine Hicham Bouhlal Laurent Belec

Lactoferrin (LF), a multifunctional molecule present in human secretions, has potent inhibitory activities against human immunodeficiency virus (HIV). The aim of the study was to evaluate whether human LF (hLF) and its exposed domain LF-33 represented by the peptide (LF-33-GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP) involved in LF-HIV gag binding and endotoxines neutralization, may inhibit early steps o...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید