نتایج جستجو برای: leishmania majorartemisia auchery boissbalbc miceherbal extractglucantime
تعداد نتایج: 13648 فیلتر نتایج به سال:
OBJECTIVES This study was performed to investigate the activity of tamoxifen, an antioestrogen widely used in the treatment of breast cancer, against Leishmania. METHODS Drug activity was assessed in vitro against axenically grown promastigotes and amastigotes through cell counting or by measuring the cleavage of MTT, and against intracellular amastigotes by treating infected macrophage cultu...
A leishmaniose é uma zoonose causada por um protozoário do reino Protista gênero Leishmania. É problema de saúde pública com prognóstico desfavorável para animais contaminados. cidade Unaí – MG no noroeste mineiro considerada área endêmica da enfermidade, grande casuística em e humanos. Foi atendido cão queixa prolapso retal; porém, após investigação clínica averiguou-se a presença seborreia, l...
The detection and identification of natural infections in sand flies by Leishmania protozoan species in endemic areas is a key factor in assessing the risk of leishmaniasis and in designing prevention and control measures for this infectious disease. In this study, we analyzed the Leishmania DNA using nuclear ribosomal internal transcript spacer (ITS) sequences. Parasite DNA was extracted from ...
The Leishmania species cause a variety of human disease syndromes. Methods for diagnosis and species differentiation are insensitive and many require invasive sampling. Although quantitative PCR (qPCR) methods are reported for leishmania detection, no systematic method to quantify parasites and determine the species in clinical specimens is established. We developed a serial qPCR strategy to id...
Leishmania internalize hemoglobin (Hb) via a specific receptor (HbR) for their survival. To identify the Hb-binding domain of HbR, we cloned and expressed several truncated proteins HbR determined ability to bind Hb. Our findings reveal that 90% activity is retained in HbR41–80 comparison with HbR1–471. We synthesized 40 amino acid peptide (SSEKMKQLTMYMIHEMVEGLEGRPSTVRMLPSFVYTSDPA) correspondin...
BACKGROUND Rapid diagnosis of cutaneous leishmaniasis (CL) and identification of Leishmania species is highly important for the disease management. In Israel, CL is caused mainly by Leishmania major and Leishmania tropica species. METHODS We established an easy to handle point of care lesion-swabbing, combined with a highly sensitive multiplex real time PCR (multiplex qPCR) for accurate and r...
Total antigen from Leishmania (Leishmania) amazonensis and isolates from the Leishmania braziliensis complex, along with their respective antigenic fractions obtained by affinity chromatography on concanavalin-A-Sepharose and jacalin-agarose columns evaluated using immunoenzymatic ELISA assay. For this, serum samples from 229 patients were used, grouped as American tegmental leishmaniasis (n=58...
Transcriptome Analysis May Be Beneficial for Identification of Specific Pathways in Host Cell-Leishmania major Interactions(letter to editor)
Leishmaniasis is a disease caused by a malaria-like parasite called Leishmania in human and some species of animals. Detection of leishmaniasis has always been crucial for control and treatment of the disease. Different strategies have been approached for detection of leishmania. In this review methods used for detection of leishmania infection have been discussed and compared. Key word: Leishm...
نمودار تعداد نتایج جستجو در هر سال
با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید