نتایج جستجو برای: nonporous silica nanoparticles

تعداد نتایج: 139025  

2012
Wei Li Yaohui Xu Yang Zhou Wenhui Ma Shixing Wang Yongnian Dai

Silica nanoparticles have been functionalized by click chemistry and atom transfer radical polymerization (ATRP) simultaneously. First, the silanized silica nanoparticles were modified with bromine end group, and then the azide group was grafted onto the surface via covalent coupling. 3-Bromopropyl propiolate was synthesized, and then the synthesized materials were used to react with azide-modi...

Journal: :ACS Nano 2021

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for antimicrobial peptide LL-37 ([LL-37, 37 aa]). doing so, smooth mesoporous were compared to virus-like nanoparticles, characterized by a “spiky” external surface, well nonporous nanoparticles. For this, employed combination neutron reflectometry, ellipsometry, dynamic ...

2012
Kyeongah Kang Jong-Seok Lim

Silica is one of the most abundant compounds found in nature. Immoderate exposure to crystalline silica has been linked to pulmonary disease and crystalline silica has been classified as a Group I carcinogen. Ultrafine (diameter <100 nm) silica particles may have different toxicological properties compared to larger particles. We evaluated the effect of ultrafine silica nanoparticles on mouse b...

2011
Aurélien Auger Jorice Samuel Olivier Poncelet Olivier Raccurt

Numerous luminophores may be encapsulated into silica nanoparticles (< 100 nm) using the reverse microemulsion process. Nevertheless, the behaviour and effect of such luminescent molecules appear to have been much less studied and may possibly prevent the encapsulation process from occurring. Such nanospheres represent attractive nanoplatforms for the development of biotargeted biocompatible lu...

2011
Xun Lu Jiangchao Qian Huanjun Zhou Qi Gan Wei Tang Jingxiong Lu Yuan Yuan Changsheng Liu

BACKGROUND Silica nanoparticles have been discovered to exert cytotoxicity and induce apoptosis in normal human cells. However, until now, few studies have investigated the cytotoxicity of silica nanoparticles in tumor cells. METHODS This study investigated the cytotoxicity of 7-50 nm silica nanoparticles in human HepG2 hepatoma cells, using normal human L-02 hepatocytes as a control. Cell nu...

2018
Christian Sögaard Johan Funehag Zareen Abbas

At present there is a pressing need to find an environmentally friendly grouting material for the construction of tunnels. Silica nanoparticles hold great potential of replacing the organic molecule based grouting materials currently used for this purpose. Chemically, silica nanoparticles are similar to natural silicates which are essential components of rocks and soil. Moreover, suspensions of...

Journal: :Chemical communications 2011
Yu-Shen Lin Nardine Abadeer Christy L Haynes

In this work, sub-50 nm pegylated mesoporous silica nanoparticles prepared with hydrothermal treatment are shown to have long-term stability in various media at both room and physiological temperature. Compared to bare mesoporous silica nanoparticles, the highly pegylated mesoporous silica nanoparticles show significantly improved biocompatibility and decreased macrophage uptake, making these n...

2012
M. Ishizaki T. Fuchigami T. Katagiri T. Sasagawa Y. Kitamoto O. Odawara H. Wada

The effect of silica-capping on the afterglow property of Sr2MgSi2O7:Eu,Dy nanoparticles was investigated. Sr2MgSi2O7:Eu,Dy nanoparticles were prepared by laser ablation in liquid. Afterglow nanoparticles were capped with silica using Stöber method. A dense silica capping layer was achieved after 4 hours of reaction. Silica-capping of the afterglow nanoparticles improved the particles’ afterglo...

Journal: :international journal of nano dimension 0
tayseir mohammed abd ellateif chemical engineering department, universiti teknologi petronas, tronoh-31750, perak, malaysia saikat maitra government college of engineering and ceramic technology, kolkata-700010, india

in the present investigation surface modification of silica nanoparticles by alumina was carried out by sol-gel process. fourier transform infrared (ftir) and x-ray fluorescence (xrf) confirmed the synthesis of silica and the surface modification as alumina is anchored to silica surface. field emission scanning electron microscopy (fesem) and transmission electron microscopy (tem) investigation...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید