نتایج جستجو برای: promastigote
تعداد نتایج: 940 فیلتر نتایج به سال:
background: sensitive and glucantime (ma) resistance leishmania tropica are referred to those isolates, which are responsive, or non-responsive to one or two full courses of treatment by ma systematically and/or intra-lesionally, respectively. in this study, we evaluated the antileishmanial activity of biogenic selenium nanoparticles (se nps) alone and in combination with ma against sensitive a...
background: cutaneous leishmaniasis due to leishmania major has become a hot topic in iran. the objective of this study was to determine some ecological aspects of sand flies in the study area. methods: sand flies were collected biweekly from indoors and outdoors fixed places in the selected villages, using 30 sticky paper traps from the beginning to the end of the active season of 2006 in kerm...
OBJECTIVES To evaluate the in vitro leishmanicidal activity of imidazole-based (1-4) and pyrazole-based (5-6) benzo[g]phthalazine derivatives against Leishmania infantum and Leishmania braziliensis. METHODS The in vitro activity of compounds 1-6 was assayed on extracellular promastigote and axenic amastigote forms, and on intracellular amastigote forms of the parasites. Infectivity and cytoto...
Among neglected tropical diseases, leishmaniasis is one of the most important ones, affecting more than 12 million people worldwide. The available treatments are not well tolerated, and present diverse side effects, justifying the search for new therapeutic compounds. In the present study, the activity of ursolic acid (UA) and oleanolic acid (OA) were assayed in experimental cutaneous leishmani...
BACKGROUND In order to proceed through their life cycle, Leishmania parasites switch between sandflies and mammals. The flagellated promastigote cells transmitted by the insect vector are phagocytized by macrophages within the mammalian host and convert into the amastigote stage, which possesses a rudimentary flagellum only. During an earlier proteomic study of the stage differentiation of the ...
Leishmania internalize hemoglobin (Hb) via a specific receptor (HbR) for their survival. To identify the Hb-binding domain of HbR, we cloned and expressed several truncated proteins HbR determined ability to bind Hb. Our findings reveal that 90% activity is retained in HbR41–80 comparison with HbR1–471. We synthesized 40 amino acid peptide (SSEKMKQLTMYMIHEMVEGLEGRPSTVRMLPSFVYTSDPA) correspondin...
zoonotic cutaneous leishmaniosis is endemic in chabahar area, south east of iran. in order to determine the natural leptomonad infection of phlebotomine sandflies caught from rodent burrows, an investigation was carried out in three foci of this area during june to october 1997. sandflies were collected by sticky traps, placed at the openings of meriones hurrianae and tatera indica burrows. tot...
نمودار تعداد نتایج جستجو در هر سال
با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید