High degree of similarity between Chromatium vinosum and Chromatium minutissimum as revealed by riboprinting.
نویسندگان
چکیده
The riboprinting technique (restriction fragment length polymorphism [RFLP] analysis of PCR-amplified ribosomal DNA) was used to study five strains representing three species of the genus Chromatium. An RFLP analysis following digestion of the amplified small-subunit ribosomal DNA with 25 restriction enzymes revealed that the patterns obtained for all strains of Chromatium vinosum were identical. Chromatium gracile was different from C. vinosum with seven enzymes. On the other hand, Chromatium minutissimum produced the same patterns as C. vinosum with all enzymes, indicating that these organisms have a high degree of similarity. An RFLP analysis of the PCR-amplified spacer sequence between the 16S and 23S ribosomal DNAs gave similar results except that there was a larger number of differences between C. gracile and the other organisms examined.
منابع مشابه
Phylogenetic relationships among the Chromatiaceae , their taxonomic reclassification and description of the new genera
lnstitut fur Meereskunde an der Universitat Kiel, Abteilung Marine Mikrobiologie, Dusternbrooker Weg 20, D-24105 Kiel, Germany Sequences of the 16s rDNA from all available type strains of Chromatium species have been determined and were compared to those of other Chromatiaceae, a few selected Ectothiorhodospiraceae and Escherichia coli. The clear separation of Ectothiorhodospiraceae and Chromat...
متن کاملSurface structure of Chromatium okenii and Chromatium weissei.
The outermost structured layer of both Chromatium weissei and C. okenii is composed of a hexagonal array of hollow cone-shaped subunits approximately 25 nm in length and 13 nm in diameter.
متن کاملAn investigation of Chromatium vinosum high-potential iron-sulfur protein by EPR and Mossbauer spectroscopy; evidence for a freezing-induced dimerization in NaCI solutions
The high-potential icon-sulfur protein (HiPIP) from Chromatium vinosum contains a cubane prosthetic group that shuttles between the [4Fe-4SP +.2 + states. We find that the EPR spectra from this protein can be explained as a sum of two components, a m ~ o r one with g = 2.02; 2.04; 2.12, and a minor one with g = 2.04; 2.07; --2.13. In the presence of 0 .1-2 .0 M NaCI, freezing induces polymeriza...
متن کاملCloning a gene encoding a light-harvesting I polypeptide from Ectothiorhodospira sp.
Trying to detect the genes coding for light harvesting II polypeptides of the purple bacteria Ectothiorhodospira sp. a gene corresponding to a light harvesting I polypeptide was cloned. This paper discusses the probable reasons of this result. The sequence of this polypeptide underlines the strong similarity with light harvesting complexes from bacteria such as Rhodospirillum molischianum and C...
متن کاملCovalent structure of the diheme cytochrome subunit and amino-terminal sequence of the flavoprotein subunit of flavocytochrome c from Chromatium vinosum.
The complete sequence of the 21-kDa cytochrome subunit of the flavocytochrome c (FC) from the purple phototrophic bacterium Chromatium vinosum has been determined to be as follows: EPTAEMLTNNCAGCHG THGNSVGPASPSIAQMDPMVFVEVMEGFKSGEIAS TIMGRIAKGYSTADFEKMAGYFKQQTYQPAKQSF DTALADTGAKLHDKYCEKCHVEGGKPLADEEDY HILAGQWTPYLQYAMSDFREERRPMEKKMASKL RELLKAEGDAGLDALFAFYASQQ. The sequence is the first example o...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
عنوان ژورنال:
- International journal of systematic bacteriology
دوره 46 4 شماره
صفحات -
تاریخ انتشار 1996