نتایج جستجو برای: leishmania infuntum

تعداد نتایج: 13647  

Journal: :The Journal of antimicrobial chemotherapy 2007
Danilo C Miguel Jenicer K U Yokoyama-Yasunaka Walter K Andreoli Renato A Mortara Silvia R B Uliana

OBJECTIVES This study was performed to investigate the activity of tamoxifen, an antioestrogen widely used in the treatment of breast cancer, against Leishmania. METHODS Drug activity was assessed in vitro against axenically grown promastigotes and amastigotes through cell counting or by measuring the cleavage of MTT, and against intracellular amastigotes by treating infected macrophage cultu...

Journal: :Pubvet 2023

A leishmaniose é uma zoonose causada por um protozoário do reino Protista gênero Leishmania. É problema de saúde pública com prognóstico desfavorável para animais contaminados. cidade Unaí – MG no noroeste mineiro considerada área endêmica da enfermidade, grande casuística em e humanos. Foi atendido cão queixa prolapso retal; porém, após investigação clínica averiguou-se a presença seborreia, l...

2017
Cristina Quiroga Varsovia Cevallos Diego Morales Manuel E Baldeón Paúl Cárdenas Patricio Rojas-Silva Patricio Ponce

The detection and identification of natural infections in sand flies by Leishmania protozoan species in endemic areas is a key factor in assessing the risk of leishmaniasis and in designing prevention and control measures for this infectious disease. In this study, we analyzed the Leishmania DNA using nuclear ribosomal internal transcript spacer (ITS) sequences. Parasite DNA was extracted from ...

Journal: :Journal of clinical microbiology 2011
Jason L Weirather Selma M B Jeronimo Shalini Gautam Shyam Sundar Mitchell Kang Melissa A Kurtz Rashidul Haque Albert Schriefer Sinésio Talhari Edgar M Carvalho John E Donelson Mary E Wilson

The Leishmania species cause a variety of human disease syndromes. Methods for diagnosis and species differentiation are insensitive and many require invasive sampling. Although quantitative PCR (qPCR) methods are reported for leishmania detection, no systematic method to quantify parasites and determine the species in clinical specimens is established. We developed a serial qPCR strategy to id...

Journal: :FEBS Letters 2021

Leishmania internalize hemoglobin (Hb) via a specific receptor (HbR) for their survival. To identify the Hb-binding domain of HbR, we cloned and expressed several truncated proteins HbR determined ability to bind Hb. Our findings reveal that 90% activity is retained in HbR41–80 comparison with HbR1–471. We synthesized 40 amino acid peptide (SSEKMKQLTMYMIHEMVEGLEGRPSTVRMLPSFVYTSDPA) correspondin...

2017
Orli Sagi Anat Berkowitz Shlomi Codish Victor Novack Aviv Rashti Fouad Akad Yonat Shemer-Avni

BACKGROUND Rapid diagnosis of cutaneous leishmaniasis (CL) and identification of Leishmania species is highly important for the disease management. In Israel, CL is caused mainly by Leishmania major and Leishmania tropica species. METHODS We established an easy to handle point of care lesion-swabbing, combined with a highly sensitive multiplex real time PCR (multiplex qPCR) for accurate and r...

2008
Adriano Gomes-Silva Maria Aparecida Souza Sandra Regina Afonso-Cardoso Lívia Resende Andrade Reynaldo Dietze Elenice Lemos Alejandro Belli Silvio Favoreto Júnior Marcelo Simão Ferreira

Total antigen from Leishmania (Leishmania) amazonensis and isolates from the Leishmania braziliensis complex, along with their respective antigenic fractions obtained by affinity chromatography on concanavalin-A-Sepharose and jacalin-agarose columns evaluated using immunoenzymatic ELISA assay. For this, serum samples from 229 patients were used, grouped as American tegmental leishmaniasis (n=58...

Journal: :Medical laboratory journal 2022

Transcriptome Analysis May Be Beneficial for Identification of Specific Pathways in Host Cell-Leishmania major Interactions(letter to editor)

2014
Hossein Rezvan

Leishmaniasis is a disease caused by a malaria-like parasite called Leishmania in human and some species of animals. Detection of leishmaniasis has always been crucial for control and treatment of the disease. Different strategies have been approached for detection of leishmania. In this review methods used for detection of leishmania infection have been discussed and compared. Key word: Leishm...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید